RBP1 Antikörper (Middle Region)

Produktnummer ABIN629847

Produktdetails anti-RBP1 Antikörper

Target: RBP1 (Retinol Binding Protein 1, Cellular (RBP1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBP1 antibody was raised against the middle region of RBP1

Aufreinigung: Purified

Immunogen: RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBP1 Blocking Peptide, catalog no. 33R-4007, is also available for use as a blocking control in assays to test for specificity of this RBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBP1

Target: RBP1 (Retinol Binding Protein 1, Cellular (RBP1))

Andere Bezeichnung: RBP1 (RBP1 Produkte)

Synonyme: RBBP-1 antikoerper, RBBP1 antikoerper, RBP-1 antikoerper, RBP1 antikoerper, CRABP-I antikoerper, CRBP antikoerper, CRBP1 antikoerper, CRBPI antikoerper, RBPC antikoerper, cb465 antikoerper, rbp1 antikoerper, wu:fb75e07 antikoerper, zgc:73335 antikoerper, CRABP1 antikoerper, Crbp antikoerper, Rbp-1 antikoerper, rbp1b antikoerper, sb:eu611 antikoerper, zgc:100825 antikoerper, AT-rich interaction domain 4A antikoerper, retinol binding protein 1 antikoerper, retinol binding protein 1a, cellular antikoerper, retinol binding protein 1 L homeolog antikoerper, retinol binding protein 1, cellular antikoerper, retinol binding protein 1b, cellular antikoerper, ARID4A antikoerper, RBP1 antikoerper, rbp5 antikoerper, rbp1.L antikoerper, rbp1 antikoerper, Rbp1 antikoerper

Hintergrund: RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision.

Molekulargewicht: 15 kDa (MW of target protein)