RBP1 Antikörper (Middle Region)

Produktnummer ABIN629847

Dieses Anti-RBP1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RBP1 in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für RBP1 Antikörper (Middle Region) (ABIN629847)

Target: RBP1 (Retinol Binding Protein 1, Cellular (RBP1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RBP1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RBP1 antibody was raised against the middle region of RBP1

Aufreinigung: Purified

Immunogen: RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBP1 Blocking Peptide, (ABIN939393), is also available for use as a blocking control in assays to test for specificity of this RBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBP1

Target: RBP1 (Retinol Binding Protein 1, Cellular (RBP1))

Andere Bezeichnung: RBP1

Hintergrund: RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision.

Molekulargewicht: 15 kDa (MW of target protein)