PRPS2 Antikörper (Middle Region)

Produktnummer ABIN629843

Der Kaninchen Polyklonal anti-PRPS2 Antikörper wird verwendet zum Nachweis von PRPS2 in Proben von Human, Ratte, Maus, Hund und Drosophila melanogaster. Er wurde validiert für WB.

Kurzübersicht für PRPS2 Antikörper (Middle Region) (ABIN629843)

Target: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Reaktivität: Human, Ratte, Maus, Hund, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRPS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PRPS2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PRPS2 antibody was raised against the middle region of PRPS2

Aufreinigung: Purified

Immunogen: PRPS2 antibody was raised using the middle region of PRPS2 corresponding to a region with amino acids ENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRPS2 Blocking Peptide, (ABIN937994), is also available for use as a blocking control in assays to test for specificity of this PRPS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRPS2

Target: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Andere Bezeichnung: PRPS2

Hintergrund: PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The PRPS2 protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process