KYNU Antikörper
-
- Target Alle KYNU Antikörper anzeigen
- KYNU (Kynureninase (L-Kynurenine Hydrolase) (KYNU))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KYNU Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- KYNU antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK
- Top Product
- Discover our top product KYNU Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KYNU Blocking Peptide, catalog no. 33R-5947, is also available for use as a blocking control in assays to test for specificity of this KYNU antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KYNU antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KYNU (Kynureninase (L-Kynurenine Hydrolase) (KYNU))
- Andere Bezeichnung
- KYNU (KYNU Produkte)
- Synonyme
- BA2753 antikoerper, 4432411A05Rik antikoerper, Kynureninase antikoerper, kynureninase antikoerper, kynureninase (L-kynurenine hydrolase) antikoerper, kynu-1 antikoerper, kynU antikoerper, CNC03980 antikoerper, Mrub_2118 antikoerper, Ndas_0787 antikoerper, Trad_2365 antikoerper, Ftrac_2835 antikoerper, Celal_2292 antikoerper, Deima_1563 antikoerper, Celly_0597 antikoerper, Deipr_2230 antikoerper, Fluta_1605 antikoerper, Halhy_3696 antikoerper, Mesop_4277 antikoerper, KYNU antikoerper, Kynu antikoerper
- Hintergrund
- Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway.
- Molekulargewicht
- 52 kDa (MW of target protein)
-