RGS16 Antikörper (C-Term)

Produktnummer ABIN629833

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RGS16 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für RGS16 Antikörper (C-Term) (ABIN629833)

Target: RGS16 (Regulator of G-Protein Signaling 16 (RGS16))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RGS16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RGS16 Antikörper

Bindungsspezifität: C-Term

Spezifität: RGS16 antibody was raised against the C terminal of RGS16

Aufreinigung: Purified

Immunogen: RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RGS16 Blocking Peptide, (ABIN937228), is also available for use as a blocking control in assays to test for specificity of this RGS16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RGS16

Target: RGS16 (Regulator of G-Protein Signaling 16 (RGS16))

Andere Bezeichnung: RGS16

Hintergrund: RGS16 belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling