HSD17B6 Antikörper (N-Term)

Produktnummer ABIN629831

Produktdetails anti-HSD17B6 Antikörper

Target: HSD17B6 (Hydroxysteroid (17-Beta) Dehydrogenase 6 (HSD17B6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSD17B6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: HSD17 B6 antibody was raised against the N terminal of HSD17 6

Aufreinigung: Purified

Immunogen: HSD17 B6 antibody was raised using the N terminal of HSD17 6 corresponding to a region with amino acids MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSD17B6 Blocking Peptide, catalog no. 33R-6617, is also available for use as a blocking control in assays to test for specificity of this HSD17B6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSD17B6

Target: HSD17B6 (Hydroxysteroid (17-Beta) Dehydrogenase 6 (HSD17B6))

Andere Bezeichnung: HSD17B6 (HSD17B6 Produkte)

Synonyme: HSE antikoerper, RODH antikoerper, SDR9C6 antikoerper, 17betaHSD9 antikoerper, Hsd17b9 antikoerper, Rdh8 antikoerper, hydroxysteroid 17-beta dehydrogenase 6 antikoerper, hydroxysteroid (17-beta) dehydrogenase 6 antikoerper, HSD17B6 antikoerper, Hsd17b6 antikoerper

Hintergrund: HSD17B6 has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. HSD17B6 is a member of the retinol dehydrogenase family.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis