ZBP1 Antikörper (Middle Region)

Produktnummer ABIN629830

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ZBP1 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für ZBP1 Antikörper (Middle Region) (ABIN629830)

Target: ZBP1 (Z-DNA Binding Protein 1 (ZBP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ZBP1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ZBP1 antibody was raised against the middle region of ZBP1

Aufreinigung: Purified

Immunogen: ZBP1 antibody was raised using the middle region of ZBP1 corresponding to a region with amino acids LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZBP1

Target: ZBP1 (Z-DNA Binding Protein 1 (ZBP1))

Andere Bezeichnung: ZBP1

Hintergrund: ZBP1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.

Molekulargewicht: 47 kDa (MW of target protein)