PRPS2 Antikörper (N-Term)

Produktnummer ABIN629828

Der Kaninchen Polyklonal Anti-PRPS2-Antikörper wurde für WB validiert. Er ist geeignet, PRPS2 in Proben von Human, Ratte, Maus und Hund zu detektieren.

Kurzübersicht für PRPS2 Antikörper (N-Term) (ABIN629828)

Target: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRPS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PRPS2 Antikörper

Bindungsspezifität: N-Term

Spezifität: PRPS2 antibody was raised against the N terminal of PRPS2

Aufreinigung: Purified

Immunogen: PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRG

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRPS2 Blocking Peptide, (ABIN5615585), is also available for use as a blocking control in assays to test for specificity of this PRPS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRPS2

Target: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Andere Bezeichnung: PRPS2

Hintergrund: PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process