UROD Antikörper (N-Term)

Produktnummer ABIN629827

Produktdetails anti-UROD Antikörper

Target: UROD (Uroporphyrinogen Decarboxylase (UROD))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UROD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: UROD antibody was raised against the N terminal of UROD

Aufreinigung: Purified

Immunogen: UROD antibody was raised using the N terminal of UROD corresponding to a region with amino acids SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UROD Blocking Peptide, catalog no. 33R-8607, is also available for use as a blocking control in assays to test for specificity of this UROD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UROD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UROD

Target: UROD (Uroporphyrinogen Decarboxylase (UROD))

Andere Bezeichnung: UROD (UROD Produkte)

Synonyme: UROD antikoerper, pct antikoerper, wu:fc43e09 antikoerper, PCT antikoerper, UPD antikoerper, AI323803 antikoerper, Uro-d antikoerper, porphyrinogen carboxy-lyase antikoerper, uroporphyrinogen decarboxylase antikoerper, Uroporphyrinogen decarboxylase UroD antikoerper, Uroporphyrinogen decarboxylase antikoerper, UROD antikoerper, urod antikoerper, hemE antikoerper, uroD antikoerper, Cpin_6502 antikoerper, Rmar_1187 antikoerper, LOC5568261 antikoerper, Mrub_1403 antikoerper, Arnit_2230 antikoerper, Ndas_2830 antikoerper, Mesil_2989 antikoerper, Trad_0222 antikoerper, Weevi_0432 antikoerper, Hipma_1229 antikoerper, Fluta_0529 antikoerper, Marky_1143 antikoerper, Halhy_5610 antikoerper, Mesop_0899 antikoerper, Ccan_20670 antikoerper, Urod antikoerper

Hintergrund: UROD is the fifth enzyme of the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.

Molekulargewicht: 40 kDa (MW of target protein)