TCAP Antikörper

Produktnummer ABIN629822

Der Kaninchen Polyklonal anti-TCAP Antikörper wird verwendet zum Nachweis von TCAP in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für TCAP Antikörper (ABIN629822)

Target: TCAP (Titin-Cap (Telethonin) (TCAP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TCAP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TCAP Antikörper

Aufreinigung: Purified

Immunogen: TCAP antibody was raised using a synthetic peptide corresponding to a region with amino acids IQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSM

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TCAP Blocking Peptide, (ABIN939503), is also available for use as a blocking control in assays to test for specificity of this TCAP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCAP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TCAP

Target: TCAP (Titin-Cap (Telethonin) (TCAP))

Andere Bezeichnung: TCAP

Hintergrund: Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. TCAP is a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in TCAP gene are associated with limb-girdle muscular dystrophy type 2G.

Molekulargewicht: 19 kDa (MW of target protein)