TCAP Antikörper
-
- Target Alle TCAP Antikörper anzeigen
- TCAP (Titin-Cap (Telethonin) (TCAP))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TCAP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- TCAP antibody was raised using a synthetic peptide corresponding to a region with amino acids IQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSM
- Top Product
- Discover our top product TCAP Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TCAP Blocking Peptide, catalog no. 33R-4117, is also available for use as a blocking control in assays to test for specificity of this TCAP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCAP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TCAP (Titin-Cap (Telethonin) (TCAP))
- Andere Bezeichnung
- TCAP (TCAP Produkte)
- Synonyme
- TCAP antikoerper, CMD1N antikoerper, LGMD2G antikoerper, T-cap antikoerper, TELE antikoerper, telethonin antikoerper, AI503981 antikoerper, AJ223855 antikoerper, titin-cap antikoerper, titin-cap (telethonin) antikoerper, titin-cap S homeolog antikoerper, TCAP antikoerper, tcap antikoerper, tcap.S antikoerper, Tcap antikoerper
- Hintergrund
- Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. TCAP is a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in TCAP gene are associated with limb-girdle muscular dystrophy type 2G.
- Molekulargewicht
- 19 kDa (MW of target protein)
-