EXD (C-Term) Antikörper

Produktnummer ABIN629819

Produktdetails

Target: EXD

Bindungsspezifität: C-Term

Reaktivität: Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EXD antibody was raised against the C terminal Of Exd

Aufreinigung: Purified

Immunogen: EXD antibody was raised using the C terminal Of Exd corresponding to a region with amino acids EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXD Blocking Peptide, catalog no. 33R-2263, is also available for use as a blocking control in assays to test for specificity of this EXD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: EXD

Synonyme: CG8933 antikoerper, DExd antikoerper, Dm-EXD antikoerper, Dmel\CG8933 antikoerper, Dpbx antikoerper, EXD antikoerper, Exd antikoerper, Pbx1 antikoerper, anon-EST:fe1H3 antikoerper, l(1)IV antikoerper, lincRNA.S9404 antikoerper, td48 antikoerper, extradenticle antikoerper, exd antikoerper

Hintergrund: As a transcription factor, exd acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless, teashirt and decapentaplegic. Thus exd affects segmental identity.

Molekulargewicht: 42 kDa (MW of target protein)