HSP70 1A Antikörper (Middle Region)
-
- Target Alle HSP70 1A (HSPA1A) Antikörper anzeigen
- HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund, C. elegans, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HSP70 1A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HSPA1 A antibody was raised against the middle region of HSPA1
- Aufreinigung
- Purified
- Immunogen
- HSPA1 A antibody was raised using the middle region of HSPA1 corresponding to a region with amino acids SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV
- Top Product
- Discover our top product HSPA1A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HSPA1A Blocking Peptide, catalog no. 33R-8583, is also available for use as a blocking control in assays to test for specificity of this HSPA1A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))
- Andere Bezeichnung
- HSPA1A (HSPA1A Produkte)
- Synonyme
- hsp70-4 antikoerper, hspa1a antikoerper, Hsp70-3 antikoerper, Hsp70.3 antikoerper, Hsp72 antikoerper, hsp68 antikoerper, hsp70A1 antikoerper, HSP72 antikoerper, Hsp70-1 antikoerper, Hspa1 antikoerper, Hspa1b antikoerper, hsp70-1 antikoerper, hsp70-1a antikoerper, hsp70i antikoerper, hsp72 antikoerper, hspa1 antikoerper, hspa1b antikoerper, HSP70-1 antikoerper, HSP70-1A antikoerper, HSP70I antikoerper, HSPA1 antikoerper, HSPA1A antikoerper, HSPA1B antikoerper, HSP70-2 antikoerper, HSPA2 antikoerper, HSP70 antikoerper, hspA1A antikoerper, heat shock cognate 70-kd protein, tandem duplicate 3 antikoerper, heat shock 70 kDa protein 1 antikoerper, heat shock 70 kDa protein II antikoerper, heat shock protein 1A antikoerper, heat shock 70kD protein 1A antikoerper, heat shock protein family A (Hsp70) member 1A S homeolog antikoerper, heat shock protein family A (Hsp70) member 1A antikoerper, heat shock protein 70.2 antikoerper, heat shock 70kDa protein 1A antikoerper, heat shock 70 kDa protein 1B antikoerper, heat shock protein 70.1 antikoerper, hsp70.3 antikoerper, LOC100023597 antikoerper, LOC100554002 antikoerper, LOC100608888 antikoerper, Hspa1a antikoerper, hspa1a.S antikoerper, HSPA1A antikoerper, HSP70.2 antikoerper, LOC100354037 antikoerper, HSP70.1 antikoerper
- Hintergrund
- HSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-