HSP70 1A Antikörper (Middle Region)

Produktnummer ABIN629817

Dieses Anti-HSP70 1A-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von HSP70 1A in WB. Geeignet für Human, Maus, Ratte, Hund, C. elegans und Zebrafisch (Danio rerio).

Kurzübersicht für HSP70 1A Antikörper (Middle Region) (ABIN629817)

Target: HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))

Reaktivität: Human, Maus, Ratte, Hund, C. elegans, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSP70 1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HSP70 1A Antikörper

Bindungsspezifität: Middle Region

Spezifität: HSPA1 A antibody was raised against the middle region of HSPA1

Aufreinigung: Purified

Immunogen: HSPA1 A antibody was raised using the middle region of HSPA1 corresponding to a region with amino acids SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPA1A Blocking Peptide, (ABIN5614097), is also available for use as a blocking control in assays to test for specificity of this HSPA1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSP70 1A

Target: HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))

Andere Bezeichnung: HSPA1A

Hintergrund: HSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process