PRMT1 Antikörper (Middle Region)

Produktnummer ABIN629816

Der Kaninchen Polyklonal Anti-PRMT1-Antikörper wurde für WB und IHC validiert. Er ist geeignet, PRMT1 in Proben von Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio) zu detektieren.

Kurzübersicht für PRMT1 Antikörper (Middle Region) (ABIN629816)

Target: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRMT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PRMT1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PRMT1 antibody was raised against the middle region of PRMT1

Aufreinigung: Purified

Immunogen: PRMT1 antibody was raised using the middle region of PRMT1 corresponding to a region with amino acids ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRMT1 Blocking Peptide, (ABIN938122), is also available for use as a blocking control in assays to test for specificity of this PRMT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRMT1

Target: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Andere Bezeichnung: PRMT1

Hintergrund: PRMT1 is a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4.

Molekulargewicht: 40 kDa (MW of target protein)