PUS7 Antikörper
-
- Target Alle PUS7 Produkte
- PUS7 (Pseudouridylate Synthase 7 Homolog (PUS7))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PUS7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- PUS7 antibody was raised using a synthetic peptide corresponding to a region with amino acids FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH
-
anti-Pseudouridylate Synthase 7 Homolog (PUS7) antibody
PUS7 Reaktivität: Human, Ratte, Hund, Affe WB, FACS, IF Wirt: Maus Monoclonal 5F12 unconjugated
anti-Pseudouridylate Synthase 7 Homolog (PUS7) antibodyPUS7 Reaktivität: Human, Hund, Affe WB, FACS Wirt: Maus Monoclonal 4H5 unconjugated
anti-Pseudouridylate Synthase 7 Homolog (PUS7) antibodyPUS7 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Pseudouridylate Synthase 7 Homolog (PUS7) antibodyPUS7 Reaktivität: Human, Ratte, Hund, Affe WB, FACS, IF Wirt: Maus Monoclonal 4C6 unconjugated
anti-Pseudouridylate Synthase 7 Homolog (PUS7) (AA 352-661) antibodyPUS7 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Pseudouridylate Synthase 7 Homolog (PUS7) (AA 101-150) antibodyPUS7 Reaktivität: Human, Ratte, Hund, Affe, Maus, Kaninchen, Rind (Kuh), Pferd, Xenopus laevis, Fledermaus, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-Pseudouridylate Synthase 7 Homolog (PUS7) (N-Term) antibodyPUS7 Reaktivität: Human, Ratte, Hund, Maus, Kaninchen, Rind (Kuh), Pferd, Saccharomyces cerevisiae, Ziege, Zebrafisch (Danio rerio), Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Pseudouridylate Synthase 7 Homolog (PUS7) antibodyPUS7 Reaktivität: Human, Ratte, Maus WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PUS7 Blocking Peptide, catalog no. 33R-2838, is also available for use as a blocking control in assays to test for specificity of this PUS7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUS7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PUS7 (Pseudouridylate Synthase 7 Homolog (PUS7))
- Andere Bezeichnung
- PUS7 (PUS7 Produkte)
- Synonyme
- C330017I15Rik antikoerper, RGD1307054 antikoerper, pseudouridylate synthase 7 (putative) antikoerper, pseudouridylate synthase 7 homolog antikoerper, pseudouridylate synthase 7 (putative) L homeolog antikoerper, pseudouridylate synthase 7 homolog (S. cerevisiae) antikoerper, pseudouridylate synthase 7 antikoerper, PUS7 antikoerper, LOC100449507 antikoerper, pus7 antikoerper, pus7.L antikoerper, Pus7 antikoerper
- Hintergrund
- PUS7 is involved in RNA binding, pseudouridine synthase activity and isomerase activity.
- Molekulargewicht
- 75 kDa (MW of target protein)
-
