PUS7 Antikörper

Produktnummer ABIN629814

Dieses Anti-PUS7-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PUS7 in WB. Geeignet für Human, Ratte und Maus.

Kurzübersicht für PUS7 Antikörper (ABIN629814)

Target: PUS7 (Pseudouridylate Synthase 7 Homolog (PUS7))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PUS7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PUS7 Antikörper

Aufreinigung: Purified

Immunogen: PUS7 antibody was raised using a synthetic peptide corresponding to a region with amino acids FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PUS7 Blocking Peptide, (ABIN938224), is also available for use as a blocking control in assays to test for specificity of this PUS7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUS7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PUS7

Target: PUS7 (Pseudouridylate Synthase 7 Homolog (PUS7))

Andere Bezeichnung: PUS7

Hintergrund: PUS7 is involved in RNA binding, pseudouridine synthase activity and isomerase activity.

Molekulargewicht: 75 kDa (MW of target protein)