PPCDC Antikörper (N-Term)

Produktnummer ABIN629813

Produktdetails anti-PPCDC Antikörper

Target: PPCDC (phosphopantothenoylcysteine Decarboxylase (PPCDC))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPCDC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PPCDC antibody was raised against the N terminal of PPCDC

Aufreinigung: Purified

Immunogen: PPCDC antibody was raised using the N terminal of PPCDC corresponding to a region with amino acids VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPCDC Blocking Peptide, catalog no. 33R-9859, is also available for use as a blocking control in assays to test for specificity of this PPCDC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPCDC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPCDC

Target: PPCDC (phosphopantothenoylcysteine Decarboxylase (PPCDC))

Andere Bezeichnung: PPCDC (PPCDC Produkte)

Synonyme: MDS018 antikoerper, 1810057I13Rik antikoerper, 8430432M10Rik antikoerper, RGD1306267 antikoerper, phosphopantothenoylcysteine decarboxylase antikoerper, PPCDC antikoerper, Ppcdc antikoerper

Hintergrund: Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC, one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopantetheine.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process