GINS1 Antikörper

Produktnummer ABIN629812

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch GINS1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte und Hund.

Kurzübersicht für GINS1 Antikörper (ABIN629812)

Target: GINS1 (GINS Complex Subunit 1 (Psf1 Homolog) (GINS1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GINS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GINS1 Antikörper

Aufreinigung: Purified

Immunogen: GINS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GINS1 Blocking Peptide, (ABIN5613762), is also available for use as a blocking control in assays to test for specificity of this GINS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GINS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GINS1

Target: GINS1 (GINS Complex Subunit 1 (Psf1 Homolog) (GINS1))

Andere Bezeichnung: GINS1

Hintergrund: The GINS complex plays an essential role in the initiation of DNA replication.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: DNA Replication, Synthesis of DNA