Desmin Antikörper (N-Term)

Produktnummer ABIN629811

Produktdetails anti-Desmin Antikörper

Target: Desmin (DES)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Desmin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Desmin antibody was raised against the N terminal of DES

Aufreinigung: Purified

Immunogen: Desmin antibody was raised using the N terminal of DES corresponding to a region with amino acids PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Desmin Blocking Peptide, catalog no. 33R-7209, is also available for use as a blocking control in assays to test for specificity of this Desmin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DES antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Desmin

Target: Desmin (DES)

Andere Bezeichnung: Desmin (DES Produkte)

Synonyme: DES antikoerper, des-b antikoerper, MGC80853 antikoerper, des antikoerper, csm1 antikoerper, csm2 antikoerper, desm antikoerper, cmd1i antikoerper, MGC75911 antikoerper, LOC100220724 antikoerper, desmin antikoerper, cb290 antikoerper, fb59a12 antikoerper, wu:fb59a12 antikoerper, zgc:109859 antikoerper, CSM1 antikoerper, CSM2 antikoerper, LGMD2R antikoerper, wu:fc11d08 antikoerper, zgc:154009 antikoerper, des-a antikoerper, MGC52614 antikoerper, desmin antikoerper, desmin, gene 1 L homeolog antikoerper, desmin, gene 1 antikoerper, desmin a antikoerper, desmin b antikoerper, desmin, gene 1 S homeolog antikoerper, desmin, gene 2 S homeolog antikoerper, DES antikoerper, des.1.L antikoerper, des.1 antikoerper, des antikoerper, desma antikoerper, Des antikoerper, desmb antikoerper, des.1.S antikoerper, des.2.S antikoerper

Hintergrund: DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Molekulargewicht: 52 kDa (MW of target protein)