ATIC Antikörper (N-Term)

Produktnummer ABIN629809

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ATIC in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für ATIC Antikörper (N-Term) (ABIN629809)

Target: ATIC (5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATIC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ATIC Antikörper

Bindungsspezifität: N-Term

Spezifität: ATIC antibody was raised against the N terminal of ATIC

Aufreinigung: Purified

Immunogen: ATIC antibody was raised using the N terminal of ATIC corresponding to a region with amino acids YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATIC Blocking Peptide, catalog no. 33R-10290, is also available for use as a blocking control in assays to test for specificity of this ATIC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATIC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATIC

Target: ATIC (5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC))

Andere Bezeichnung: ATIC

Hintergrund: ATIC is a bifunctional protein requiring dimerization for transformylase activity.

Molekulargewicht: 64 kDa (MW of target protein)