HBZ Antikörper (N-Term)

Produktnummer ABIN629807

Der Kaninchen Polyklonal Anti-HBZ-Antikörper wurde für WB und IHC validiert. Er ist geeignet, HBZ in Proben von Human zu detektieren.

Kurzübersicht für HBZ Antikörper (N-Term) (ABIN629807)

Target: HBZ (Hemoglobin, zeta (HBZ))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HBZ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-HBZ Antikörper

Bindungsspezifität: N-Term

Spezifität: Hemoglobin Zeta antibody was raised against the N terminal of HBZ

Aufreinigung: Purified

Immunogen: Hemoglobin Zeta antibody was raised using the N terminal of HBZ corresponding to a region with amino acids ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Hemoglobin Zeta Blocking Peptide, (ABIN938088), is also available for use as a blocking control in assays to test for specificity of this Hemoglobin Zeta antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBZ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HBZ

Target: HBZ (Hemoglobin, zeta (HBZ))

Andere Bezeichnung: Hemoglobin zeta

Hintergrund: Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes.

Molekulargewicht: 16 kDa (MW of target protein)