ADH6 Antikörper

Produktnummer ABIN629805

Produktdetails anti-ADH6 Antikörper

Target: ADH6 (Alcohol Dehydrogenase 6 (Class V) (ADH6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADH6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: ADH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADH6 Blocking Peptide, catalog no. 33R-1184, is also available for use as a blocking control in assays to test for specificity of this ADH6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADH6

Target: ADH6 (Alcohol Dehydrogenase 6 (Class V) (ADH6))

Andere Bezeichnung: ADH6 (ADH6 Produkte)

Synonyme: ADH1A antikoerper, ADH1B antikoerper, ADH-5 antikoerper, alcohol dehydrogenase 6 (class V) antikoerper, ADH6 antikoerper, Adh6 antikoerper

Hintergrund: ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.

Molekulargewicht: 32 kDa (MW of target protein)