PKLR Antikörper (N-Term)

Produktnummer ABIN629803

Produktdetails anti-PKLR Antikörper

Target: PKLR (Pyruvate Kinase, Liver and RBC (PKLR))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PKLR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: PKLR antibody was raised against the N terminal of PKLR

Aufreinigung: Purified

Immunogen: PKLR antibody was raised using the N terminal of PKLR corresponding to a region with amino acids STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PKLR Blocking Peptide, catalog no. 33R-8888, is also available for use as a blocking control in assays to test for specificity of this PKLR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PKLR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PKLR

Target: PKLR (Pyruvate Kinase, Liver and RBC (PKLR))

Andere Bezeichnung: PKLR (PKLR Produkte)

Synonyme: PK1 antikoerper, PKL antikoerper, PKR antikoerper, PKRL antikoerper, RPK antikoerper, Pklg antikoerper, wu:fd15e01 antikoerper, wu:fi37e08 antikoerper, pk1 antikoerper, PKLR antikoerper, Pk-1 antikoerper, Pk1 antikoerper, R-PK antikoerper, pklr antikoerper, pyruvate kinase L/R antikoerper, pyruvate kinase, liver and RBC antikoerper, pyruvate kinase, liver and RBC L homeolog antikoerper, pyruvate kinase liver and red blood cell antikoerper, pyruvate kinase PKLR-like antikoerper, PKLR antikoerper, Pklr antikoerper, pklr antikoerper, pklr.L antikoerper, LOC100621940 antikoerper

Hintergrund: PKLR is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA).

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process