PSD3 Antikörper (Middle Region)

Produktnummer ABIN629799

Produktdetails anti-PSD3 Antikörper

Target: PSD3 (Pleckstrin and Sec7 Domain Containing 3 (PSD3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: PSD3 antibody was raised against the middle region of PSD3

Aufreinigung: Purified

Immunogen: PSD3 antibody was raised using the middle region of PSD3 corresponding to a region with amino acids SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSD3 Blocking Peptide, catalog no. 33R-8378, is also available for use as a blocking control in assays to test for specificity of this PSD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSD3

Target: PSD3 (Pleckstrin and Sec7 Domain Containing 3 (PSD3))

Andere Bezeichnung: PSD3 (PSD3 Produkte)

Synonyme: PSD3 antikoerper, EFA6R antikoerper, HCA67 antikoerper, 4931420C21Rik antikoerper, AI661273 antikoerper, BC003498 antikoerper, D430018P08 antikoerper, EFA6D antikoerper, RGD1559968 antikoerper, pleckstrin and Sec7 domain containing 3 antikoerper, PH and SEC7 domain-containing protein 3 antikoerper, PSD3 antikoerper, LOC100476735 antikoerper, Psd3 antikoerper

Hintergrund: PSD3 is a guanine nucleotide exchange factor for ARF6.

Molekulargewicht: 56 kDa (MW of target protein)