DCTPP1 Antikörper (N-Term)
-
- Target Alle DCTPP1 Antikörper anzeigen
- DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DCTPP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- XTP3 TPA antibody was raised against the N terminal of XTP3 PA
- Aufreinigung
- Purified
- Immunogen
- XTP3 TPA antibody was raised using the N terminal of XTP3 PA corresponding to a region with amino acids MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF
- Top Product
- Discover our top product DCTPP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
XTP3TPA Blocking Peptide, catalog no. 33R-6521, is also available for use as a blocking control in assays to test for specificity of this XTP3TPA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XTP0 PA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))
- Andere Bezeichnung
- XTP3TPA (DCTPP1 Produkte)
- Hintergrund
- XTP3TPA is involved in identical protein binding, dCTP diphosphatase activity, pyrimidine deoxyribonucleotide binding and hydrolase activity.
- Molekulargewicht
- 19 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-