DCTPP1 Antikörper (N-Term)

Produktnummer ABIN629798

Produktdetails anti-DCTPP1 Antikörper

Target: DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCTPP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: XTP3 TPA antibody was raised against the N terminal of XTP3 PA

Aufreinigung: Purified

Immunogen: XTP3 TPA antibody was raised using the N terminal of XTP3 PA corresponding to a region with amino acids MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

XTP3TPA Blocking Peptide, catalog no. 33R-6521, is also available for use as a blocking control in assays to test for specificity of this XTP3TPA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XTP0 PA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCTPP1

Target: DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))

Andere Bezeichnung: XTP3TPA (DCTPP1 Produkte)

Hintergrund: XTP3TPA is involved in identical protein binding, dCTP diphosphatase activity, pyrimidine deoxyribonucleotide binding and hydrolase activity.

Molekulargewicht: 19 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom