MRGBP Antikörper (N-Term)

Produktnummer ABIN629797

Produktdetails anti-MRGBP Antikörper

Target: MRGBP (MRG-Binding Protein (MRGBP))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRGBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C20 ORF20 antibody was raised against the N terminal Of C20 rf20

Aufreinigung: Purified

Immunogen: C20 ORF20 antibody was raised using the N terminal Of C20 rf20 corresponding to a region with amino acids MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C20ORF20 Blocking Peptide, catalog no. 33R-6018, is also available for use as a blocking control in assays to test for specificity of this C20ORF20 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRGBP

Target: MRGBP (MRG-Binding Protein (MRGBP))

Andere Bezeichnung: C20ORF20 (MRGBP Produkte)

Synonyme: C20orf20 antikoerper, Eaf7 antikoerper, MRG15BP antikoerper, URCC4 antikoerper, c20orf20 antikoerper, zgc:73167 antikoerper, 1600027N09Rik antikoerper, AW060503 antikoerper, C80444 antikoerper, MRG domain binding protein antikoerper, MRG/MORF4L-binding protein antikoerper, MRG-binding protein antikoerper, putative mrg-binding protein antikoerper, MRG/MORF4L binding protein antikoerper, MRGBP antikoerper, LOC5577096 antikoerper, CpipJ_CPIJ006487 antikoerper, CpipJ_CPIJ017611 antikoerper, Smp_130630 antikoerper, mrgbp antikoerper, Mrgbp antikoerper

Hintergrund: C20orf20 is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair.

Molekulargewicht: 22 kDa (MW of target protein)