CES1 Antikörper
-
- Target Alle CES1 Antikörper anzeigen
- CES1 (Carboxylesterase 1 (CES1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CES1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- Carboxylesterase 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL
- Top Product
- Discover our top product CES1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Carboxylesterase 1 Blocking Peptide, catalog no. 33R-1397, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CES1 (Carboxylesterase 1 (CES1))
- Andere Bezeichnung
- Carboxylesterase 1 (CES1 Produkte)
- Synonyme
- ACAT antikoerper, CE-1 antikoerper, CEH antikoerper, CES2 antikoerper, HMSE antikoerper, HMSE1 antikoerper, PCE-1 antikoerper, REH antikoerper, SES1 antikoerper, TGH antikoerper, hCE-1 antikoerper, CESDD1 antikoerper, CES1 antikoerper, CES-K1 antikoerper, APLE antikoerper, PMPMEase antikoerper, CES antikoerper, carboxylesterase 1 antikoerper, liver carboxylesterase 1 antikoerper, liver carboxylesterase antikoerper, carboxylesterase 1 (monocyte/macrophage serine esterase 1) antikoerper, CES1 antikoerper, CpipJ_CPIJ013026 antikoerper, CpipJ_CPIJ016339 antikoerper, LOC100009551 antikoerper, LOC454097 antikoerper, LOC699486 antikoerper, LOC100050915 antikoerper
- Hintergrund
- CES1 is one of the enzymes responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. This enzyme is known to hydrolyze aromatic and aliphatic esters and is necessary for cellular cholesterol esterification. It may also play a role in detoxification in the lung and/or protection of the central nervous system from ester or amide compounds. Carboxylesterase deficiency may be associated with non-Hodgkin lymphoma or B-cell lymphocytic leukemia.
- Molekulargewicht
- 62 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-