CTP Synthase Antikörper (C-Term)

Produktnummer ABIN629790

Dieses Anti-CTP Synthase-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CTP Synthase in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für CTP Synthase Antikörper (C-Term) (ABIN629790)

Target: CTP Synthase (CTPS)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CTP Synthase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CTP Synthase Antikörper

Bindungsspezifität: C-Term

Spezifität: Ctp Synthase antibody was raised against the C terminal of CTPS

Aufreinigung: Purified

Immunogen: Ctp Synthase antibody was raised using the C terminal of CTPS corresponding to a region with amino acids FGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINH

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ctp Synthase Blocking Peptide, (ABIN938292), is also available for use as a blocking control in assays to test for specificity of this Ctp Synthase antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTPS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CTP Synthase

Target: CTP Synthase (CTPS)

Andere Bezeichnung: Ctp Synthase

Hintergrund: The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: Proton Transport, Ribonucleoside Biosynthetic Process