SLC38A4 Antikörper (Middle Region)

Produktnummer ABIN629787

Dieses Anti-SLC38A4-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SLC38A4 in WB und IHC. Geeignet für Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), C. elegans und Drosophila melanogaster.

Kurzübersicht für SLC38A4 Antikörper (Middle Region) (ABIN629787)

Target: SLC38A4 (Solute Carrier Family 38 Member 4 (SLC38A4))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), C. elegans, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC38A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SLC38A4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC38 A4 antibody was raised against the middle region of SLC38 4

Aufreinigung: Purified

Immunogen: SLC38 A4 antibody was raised using the middle region of SLC38 4 corresponding to a region with amino acids LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC38A4 Blocking Peptide, (ABIN940141), is also available for use as a blocking control in assays to test for specificity of this SLC38A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC38A4

Target: SLC38A4 (Solute Carrier Family 38 Member 4 (SLC38A4))

Andere Bezeichnung: SLC38A4

Hintergrund: SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.

Molekulargewicht: 17 kDa (MW of target protein)