TKTL2 Antikörper (C-Term)

Produktnummer ABIN629780

Der Kaninchen Polyklonal Anti-TKTL2-Antikörper wurde für WB validiert. Er ist geeignet, TKTL2 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für TKTL2 Antikörper (C-Term) (ABIN629780)

Target: TKTL2 (Transketolase-Like 2 (TKTL2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TKTL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TKTL2 Antikörper

Bindungsspezifität: C-Term

Spezifität: TKTL2 antibody was raised against the C terminal of TKTL2

Aufreinigung: Purified

Immunogen: TKTL2 antibody was raised using the C terminal of TKTL2 corresponding to a region with amino acids SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TKTL2 Blocking Peptide, (ABIN5616622), is also available for use as a blocking control in assays to test for specificity of this TKTL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKTL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TKTL2

Target: TKTL2 (Transketolase-Like 2 (TKTL2))

Andere Bezeichnung: TKTL2

Hintergrund: TKTL2 plays an essential role in total transketolase activity and cell proliferation in cancer cells. After transfection with anti-TKTL1 siRNA, total transketolase activity dramatically decreases and proliferation was significantly inhibited in cancer cells. TKTL2 may also play a pivotal role in carcinogenesis

Molekulargewicht: 68 kDa (MW of target protein)