GMPPB Antikörper (C-Term)

Produktnummer ABIN629777

Der Kaninchen Polyklonal Anti-GMPPB-Antikörper wurde für WB und IHC validiert. Er ist geeignet, GMPPB in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für GMPPB Antikörper (C-Term) (ABIN629777)

Target: GMPPB (GDP-Mannose Pyrophosphorylase B (GMPPB))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GMPPB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-GMPPB Antikörper

Bindungsspezifität: C-Term

Spezifität: GMPPB antibody was raised against the C terminal of GMPPB

Aufreinigung: Purified

Immunogen: GMPPB antibody was raised using the C terminal of GMPPB corresponding to a region with amino acids RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GMPPB Blocking Peptide, (ABIN5613802), is also available for use as a blocking control in assays to test for specificity of this GMPPB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPPB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GMPPB

Target: GMPPB (GDP-Mannose Pyrophosphorylase B (GMPPB))

Andere Bezeichnung: GMPPB

Hintergrund: GMPPB is a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides.

Molekulargewicht: 43 kDa (MW of target protein)