FNTA Antikörper (C-Term)

Produktnummer ABIN629775

Der Kaninchen Polyklonal anti-FNTA Antikörper (ABIN629775) detektiert spezifisch FNTA in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für FNTA Antikörper (C-Term) (ABIN629775)

Target: FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FNTA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FNTA Antikörper

Bindungsspezifität: C-Term

Spezifität: FNTA antibody was raised against the C terminal of FNTA

Aufreinigung: Purified

Immunogen: FNTA antibody was raised using the C terminal of FNTA corresponding to a region with amino acids DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FNTA Blocking Peptide, (ABIN937469), is also available for use as a blocking control in assays to test for specificity of this FNTA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNTA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FNTA

Target: FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))

Andere Bezeichnung: FNTA

Hintergrund: Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. FNTA is the alpha subunit of these transferases.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Regulation of G-Protein Coupled Receptor Protein Signaling