FNTA Antikörper (C-Term)

Produktnummer ABIN629775

Produktdetails anti-FNTA Antikörper

Target: FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FNTA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FNTA antibody was raised against the C terminal of FNTA

Aufreinigung: Purified

Immunogen: FNTA antibody was raised using the C terminal of FNTA corresponding to a region with amino acids DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FNTA Blocking Peptide, catalog no. 33R-2083, is also available for use as a blocking control in assays to test for specificity of this FNTA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNTA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FNTA

Target: FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))

Andere Bezeichnung: FNTA (FNTA Produkte)

Synonyme: ATFTA antikoerper, FARNESYLTRANSFERASE A antikoerper, FARNESYLTRANSFERASE SUBUNIT A antikoerper, PFT/PGGT-IALPHA antikoerper, PLP antikoerper, PLURIPETALA antikoerper, farnesyltransferase A antikoerper, FPTA antikoerper, PGGT1A antikoerper, PTAR2 antikoerper, PFAS antikoerper, FTA antikoerper, farnesyltransferase A antikoerper, farnesyltransferase, CAAX box, alpha antikoerper, FTA antikoerper, FNTA antikoerper, Fnta antikoerper

Hintergrund: Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. FNTA is the alpha subunit of these transferases.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Regulation of G-Protein Coupled Receptor Protein Signaling