EEF1G Antikörper (N-Term)

Produktnummer ABIN629773

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch EEF1G in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für EEF1G Antikörper (N-Term) (ABIN629773)

Target: EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EEF1G Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EEF1G Antikörper

Bindungsspezifität: N-Term

Spezifität: EEF1 G antibody was raised against the N terminal of EEF1

Aufreinigung: Purified

Immunogen: EEF1 G antibody was raised using the N terminal of EEF1 corresponding to a region with amino acids AAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EEF1G Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this EEF1G antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EEF1G

Target: EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))

Andere Bezeichnung: EEF1G

Hintergrund: EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.

Molekulargewicht: 50 kDa (MW of target protein)