ALT Antikörper

Produktnummer ABIN629766

Dieses Anti-ALT-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ALT in WB und IHC. Geeignet für Human, Ratte, Maus und Hund.

Kurzübersicht für ALT Antikörper (ABIN629766)

Target: ALT (Alanine Aminotransferase (ALT))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-ALT Antikörper

Aufreinigung: Purified

Immunogen: GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPT Blocking Peptide, (ABIN5613846), is also available for use as a blocking control in assays to test for specificity of this GPT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALT

Target: ALT (Alanine Aminotransferase (ALT))

Andere Bezeichnung: GPT

Hintergrund: GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.

Molekulargewicht: 55 kDa (MW of target protein)