ADH4 Antikörper
-
- Target Alle ADH4 Antikörper anzeigen
- ADH4 (Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADH4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- ADH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET
- Top Product
- Discover our top product ADH4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADH4 Blocking Peptide, catalog no. 33R-6872, is also available for use as a blocking control in assays to test for specificity of this ADH4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADH4 (Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4))
- Andere Bezeichnung
- ADH4 (ADH4 Produkte)
- Synonyme
- ADH-2 antikoerper, Adh2 antikoerper, ADH-1 antikoerper, Ac1002 antikoerper, alcohol dehydrogenase 4 (class II), pi polypeptide antikoerper, alcohol dehydrogenase Adh4 antikoerper, ADH4 antikoerper, adh4 antikoerper, Adh4 antikoerper
- Hintergrund
- ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-