SARDH Antikörper (Middle Region)

Produktnummer ABIN629761

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SARDH in WB und IHC. Er zeigt eine Reaktivität gegenüber Maus, Human, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für SARDH Antikörper (Middle Region) (ABIN629761)

Target: SARDH (Sarcosine Dehydrogenase (SARDH))

Reaktivität: Maus, Human, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SARDH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SARDH Antikörper

Bindungsspezifität: Middle Region

Spezifität: SARDH antibody was raised against the middle region of SARDH

Aufreinigung: Purified

Immunogen: SARDH antibody was raised using the middle region of SARDH corresponding to a region with amino acids DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SARDH Blocking Peptide, (ABIN937368), is also available for use as a blocking control in assays to test for specificity of this SARDH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SARDH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SARDH

Target: SARDH (Sarcosine Dehydrogenase (SARDH))

Andere Bezeichnung: SARDH

Hintergrund: The protein encoded by this gene is an enzyme localized to the mitochondrial matrix which catalyzes the oxidative demethylation of sarcosine. This enzyme is distinct from another mitochondrial matrix enzyme, dimethylglycine dehydrogenase, which catalyzes a reaction resulting in the formation of sarcosine. Mutations in this gene are associated with sarcosinemia.

Molekulargewicht: 67 kDa (MW of target protein)