TSH receptor Antikörper (N-Term)
-
- Target Alle TSH receptor (TSHR) Antikörper anzeigen
- TSH receptor (TSHR) (Thyroid Stimulating Hormone Receptor (TSHR))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TSH receptor Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TSHR antibody was raised against the N terminal of TSHR
- Aufreinigung
- Purified
- Immunogen
- TSHR antibody was raised using the N terminal of TSHR corresponding to a region with amino acids CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR
- Top Product
- Discover our top product TSHR Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TSHR Blocking Peptide, catalog no. 33R-1711, is also available for use as a blocking control in assays to test for specificity of this TSHR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSHR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSH receptor (TSHR) (Thyroid Stimulating Hormone Receptor (TSHR))
- Andere Bezeichnung
- TSHR (TSHR Produkte)
- Synonyme
- CHNG1 antikoerper, LGR3 antikoerper, hTSHR-I antikoerper, AI481368 antikoerper, hypothroid antikoerper, hyt antikoerper, pet antikoerper, TSHRA antikoerper, TSH-R antikoerper, thyroid stimulating hormone receptor antikoerper, tshr antikoerper, TSHR antikoerper, Tshr antikoerper
- Hintergrund
- TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis
-