SMPX Antikörper (Middle Region)

Produktnummer ABIN629759

Der Kaninchen Polyklonal Anti-SMPX-Antikörper wurde für WB validiert. Er ist geeignet, SMPX in Proben von Human und Hund zu detektieren.

Kurzübersicht für SMPX Antikörper (Middle Region) (ABIN629759)

Target: SMPX (Small Muscle Protein, X-Linked (SMPX))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMPX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SMPX Antikörper

Bindungsspezifität: Middle Region

Spezifität: SMPX antibody was raised against the middle region of SMPX

Aufreinigung: Purified

Immunogen: SMPX antibody was raised using the middle region of SMPX corresponding to a region with amino acids TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMPX Blocking Peptide, (ABIN5616307), is also available for use as a blocking control in assays to test for specificity of this SMPX antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPX antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMPX

Target: SMPX (Small Muscle Protein, X-Linked (SMPX))

Andere Bezeichnung: SMPX

Hintergrund: SMPX plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.

Molekulargewicht: 9 kDa (MW of target protein)