SIK1 Antikörper (N-Term)

Produktnummer ABIN629758

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SIK1 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für SIK1 Antikörper (N-Term) (ABIN629758)

Target: SIK1 (Salt-Inducible Kinase 1 (SIK1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SIK1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SNF1 LK antibody was raised against the N terminal of SNF1 K

Aufreinigung: Purified

Immunogen: SNF1 LK antibody was raised using the N terminal of SNF1 K corresponding to a region with amino acids MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNF1LK Blocking Peptide, (ABIN5616317), is also available for use as a blocking control in assays to test for specificity of this SNF1LK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNF0 K antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SIK1

Target: SIK1 (Salt-Inducible Kinase 1 (SIK1))

Andere Bezeichnung: SNF1LK

Hintergrund: SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.

Molekulargewicht: 85 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Regulation of Carbohydrate Metabolic Process