LOC653186 Antikörper (N-Term)

Produktnummer ABIN629757

Produktdetails anti-LOC653186 Antikörper

Target: LOC653186

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LOC653186 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LOC653186 antibody was raised against the N terminal of LOC653186

Aufreinigung: Purified

Immunogen: LOC653186 antibody was raised using the N terminal of LOC653186 corresponding to a region with amino acids MKVINAKLDGFYSFPIFLFQFLQATAQEEGIFECADPKLAISAIWTFRDL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LOC653186 Blocking Peptide, catalog no. 33R-6172, is also available for use as a blocking control in assays to test for specificity of this LOC653186 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC653186 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LOC653186

Target: LOC653186

Andere Bezeichnung: LOC653186 (LOC653186 Produkte)

Hintergrund: The function of LOC653186 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 10 kDa (MW of target protein)