ITGB1BP2 Antikörper

Produktnummer ABIN629756

Der Kaninchen Polyklonal anti-ITGB1BP2 Antikörper wird verwendet zum Nachweis von ITGB1BP2 in Proben von Human, Maus und Ratte. Er wurde validiert für WB und IHC.

Kurzübersicht für ITGB1BP2 Antikörper (ABIN629756)

Target: ITGB1BP2 (Integrin beta 1 Binding Protein (Melusin) 2 (ITGB1BP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ITGB1BP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-ITGB1BP2 Antikörper

Aufreinigung: Purified

Immunogen: ITGB1 BP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ITGB1BP2 Blocking Peptide, (ABIN5614226), is also available for use as a blocking control in assays to test for specificity of this ITGB1BP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ITGB1BP2

Target: ITGB1BP2 (Integrin beta 1 Binding Protein (Melusin) 2 (ITGB1BP2))

Andere Bezeichnung: ITGB1BP2

Hintergrund: ITGB1BP2 may play a role during maturation and/or organization of muscles cells.

Molekulargewicht: 38 kDa (MW of target protein)