ITGB1BP2 Antikörper

Produktnummer ABIN629756

Produktdetails anti-ITGB1BP2 Antikörper

Target: ITGB1BP2 (Integrin beta 1 Binding Protein (Melusin) 2 (ITGB1BP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ITGB1BP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: ITGB1 BP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ITGB1BP2 Blocking Peptide, catalog no. 33R-6461, is also available for use as a blocking control in assays to test for specificity of this ITGB1BP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ITGB1BP2

Target: ITGB1BP2 (Integrin beta 1 Binding Protein (Melusin) 2 (ITGB1BP2))

Andere Bezeichnung: ITGB1BP2 (ITGB1BP2 Produkte)

Synonyme: CHORDC3 antikoerper, ITGB1BP antikoerper, MELUSIN antikoerper, Chordc3 antikoerper, RGD1565015 antikoerper, integrin subunit beta 1 binding protein 2 antikoerper, integrin beta 1 binding protein 2 antikoerper, ITGB1BP2 antikoerper, Itgb1bp2 antikoerper

Hintergrund: ITGB1BP2 may play a role during maturation and/or organization of muscles cells.

Molekulargewicht: 38 kDa (MW of target protein)