SBDS Antikörper (C-Term)
-
- Target Alle SBDS Antikörper anzeigen
- SBDS (Shwachman-Bodian-Diamond Syndrome (SBDS))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SBDS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SBDS antibody was raised against the C terminal of SBDS
- Aufreinigung
- Purified
- Immunogen
- SBDS antibody was raised using the C terminal of SBDS corresponding to a region with amino acids DYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
- Top Product
- Discover our top product SBDS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SBDS Blocking Peptide, catalog no. 33R-2237, is also available for use as a blocking control in assays to test for specificity of this SBDS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SBDS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SBDS (Shwachman-Bodian-Diamond Syndrome (SBDS))
- Andere Bezeichnung
- SBDS (SBDS Produkte)
- Synonyme
- cgi-97 antikoerper, sds antikoerper, swds antikoerper, zgc:56700 antikoerper, SDS antikoerper, SWDS antikoerper, 4733401P19Rik antikoerper, AI836084 antikoerper, CGI-97 antikoerper, SBDS ribosome assembly guanine nucleotide exchange factor antikoerper, hypothetical protein antikoerper, SBDS, ribosome maturation factor antikoerper, SBDS ribosome assembly guanine nucleotide exchange factor S homeolog antikoerper, SBDS ribosome maturation factor antikoerper, sbds antikoerper, LOAG_04440 antikoerper, sbds.S antikoerper, SBDS antikoerper, Sbds antikoerper
- Hintergrund
- SBDS is a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The protein may function in RNA metabolism. Mutations within its gene are associated with Shwachman-Bodian-Diamond syndrome.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-