alpha Actinin 4 Antikörper (N-Term)

Produktnummer ABIN629744

Der Kaninchen Polyklonal Anti-alpha Actinin 4-Antikörper wurde für WB validiert. Er ist geeignet, alpha Actinin 4 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für alpha Actinin 4 Antikörper (N-Term) (ABIN629744)

Target: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser alpha Actinin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-alpha Actinin 4 Antikörper

Bindungsspezifität: N-Term

Spezifität: Alpha Actinin 4 antibody was raised against the N terminal of ACTN4

Aufreinigung: Purified

Immunogen: alpha Actinin 4 antibody was raised using the N terminal of ACTN4 corresponding to a region with amino acids LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Alpha Actinin 4 Blocking Peptide, (ABIN940431), is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu alpha Actinin 4

Target: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Andere Bezeichnung: alpha Actinin 4

Hintergrund: Alpha actinins belong to the spectrin superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Alpha actinin is an actin-binding protein with multiple roles in different cell types.

Molekulargewicht: 100 kDa (MW of target protein)

Pathways: Proton Transport