RNF39 Antikörper (C-Term)

Produktnummer ABIN629742

Produktdetails anti-RNF39 Antikörper

Target: RNF39 (Ring Finger Protein 39 (RNF39))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF39 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF39 antibody was raised against the C terminal of RNF39

Aufreinigung: Purified

Immunogen: RNF39 antibody was raised using the C terminal of RNF39 corresponding to a region with amino acids CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF39 Blocking Peptide, catalog no. 33R-1798, is also available for use as a blocking control in assays to test for specificity of this RNF39 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF39 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF39

Target: RNF39 (Ring Finger Protein 39 (RNF39))

Andere Bezeichnung: RNF39 (RNF39 Produkte)

Synonyme: HZF antikoerper, HZFW antikoerper, LIRF antikoerper, Hzfw1 antikoerper, Lirf antikoerper, BC038661 antikoerper, Gm1786 antikoerper, Gm1787 antikoerper, Gm320 antikoerper, HZFW1 antikoerper, ring finger protein 39 antikoerper, RNF39 antikoerper, Rnf39 antikoerper

Hintergrund: Its gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that RNF39 plays a role in an early phase of synaptic plasticity. Its gene lies within the major histocompatibility complex class I region on chromosome 6.

Molekulargewicht: 28 kDa (MW of target protein)