RNF32 Antikörper (Middle Region)
-
- Target Alle RNF32 Antikörper anzeigen
- RNF32 (Ring Finger Protein 32 (RNF32))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNF32 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RNF32 antibody was raised against the middle region of RNF32
- Aufreinigung
- Purified
- Immunogen
- RNF32 antibody was raised using the middle region of RNF32 corresponding to a region with amino acids ACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGC
- Top Product
- Discover our top product RNF32 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNF32 Blocking Peptide, catalog no. 33R-1073, is also available for use as a blocking control in assays to test for specificity of this RNF32 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF32 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF32 (Ring Finger Protein 32 (RNF32))
- Andere Bezeichnung
- RNF32 (RNF32 Produkte)
- Synonyme
- zgc:153042 antikoerper, FKSG33 antikoerper, HSD15 antikoerper, LMBR2 antikoerper, 1700009J01Rik antikoerper, 2700025B22Rik antikoerper, 4930542N22Rik antikoerper, Lmbr2 antikoerper, ring finger protein 32 antikoerper, rnf32 antikoerper, RNF32 antikoerper, Rnf32 antikoerper
- Hintergrund
- RNF32 contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. Its gene was found to be expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids.
- Molekulargewicht
- 40 kDa (MW of target protein)
-