RNF32 Antikörper (Middle Region)

Produktnummer ABIN629739

Produktdetails anti-RNF32 Antikörper

Target: RNF32 (Ring Finger Protein 32 (RNF32))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF32 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF32 antibody was raised against the middle region of RNF32

Aufreinigung: Purified

Immunogen: RNF32 antibody was raised using the middle region of RNF32 corresponding to a region with amino acids ACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGC

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF32 Blocking Peptide, catalog no. 33R-1073, is also available for use as a blocking control in assays to test for specificity of this RNF32 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF32 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF32

Target: RNF32 (Ring Finger Protein 32 (RNF32))

Andere Bezeichnung: RNF32 (RNF32 Produkte)

Synonyme: zgc:153042 antikoerper, FKSG33 antikoerper, HSD15 antikoerper, LMBR2 antikoerper, 1700009J01Rik antikoerper, 2700025B22Rik antikoerper, 4930542N22Rik antikoerper, Lmbr2 antikoerper, ring finger protein 32 antikoerper, rnf32 antikoerper, RNF32 antikoerper, Rnf32 antikoerper

Hintergrund: RNF32 contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. Its gene was found to be expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids.

Molekulargewicht: 40 kDa (MW of target protein)