FBXO25 Antikörper (C-Term)
-
- Target Alle FBXO25 Antikörper anzeigen
- FBXO25 (F-Box Protein 25 (FBXO25))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXO25 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- FBXO25 antibody was raised against the C terminal of FBXO25
- Aufreinigung
- Purified
- Immunogen
- FBXO25 antibody was raised using the C terminal of FBXO25 corresponding to a region with amino acids AKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF
- Top Product
- Discover our top product FBXO25 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXO25 Blocking Peptide, catalog no. 33R-1290, is also available for use as a blocking control in assays to test for specificity of this FBXO25 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO25 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO25 (F-Box Protein 25 (FBXO25))
- Andere Bezeichnung
- FBXO25 (FBXO25 Produkte)
- Synonyme
- FBXO25 antikoerper, fbxo32 antikoerper, MGC108443 antikoerper, DKFZp469H2437 antikoerper, zgc:100907 antikoerper, FBX25 antikoerper, 9130015I06Rik antikoerper, AI649137 antikoerper, Fbx25 antikoerper, F-box protein 25 antikoerper, F-box protein 25 L homeolog antikoerper, FBXO25 antikoerper, fbxo25 antikoerper, fbxo25.L antikoerper, Fbxo25 antikoerper
- Hintergrund
- FBXO25 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO25 belongs to the Fbxs class.
- Molekulargewicht
- 16 kDa (MW of target protein)
-