BSDC1 Antikörper (N-Term)

Produktnummer ABIN629726

Der Kaninchen Polyklonal Anti-BSDC1-Antikörper wurde für WB und IHC validiert. Er ist geeignet, BSDC1 in Proben von Human, Maus, Hund, Ratte und Zebrafisch (Danio rerio) zu detektieren.

Kurzübersicht für BSDC1 Antikörper (N-Term) (ABIN629726)

Target: BSDC1 (BSD Domain Containing 1 (BSDC1))

Reaktivität: Human, Maus, Hund, Ratte, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BSDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-BSDC1 Antikörper

Bindungsspezifität: N-Term

Spezifität: BSDC1 antibody was raised against the N terminal of BSDC1

Aufreinigung: Purified

Immunogen: BSDC1 antibody was raised using the N terminal of BSDC1 corresponding to a region with amino acids VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BSDC1 Blocking Peptide, (ABIN5612370), is also available for use as a blocking control in assays to test for specificity of this BSDC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BSDC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BSDC1

Target: BSDC1 (BSD Domain Containing 1 (BSDC1))

Andere Bezeichnung: BSDC1

Hintergrund: BSDC1 may be involved in protein binding.

Molekulargewicht: 17 kDa (MW of target protein)