BSDC1 Antikörper (N-Term)

Produktnummer ABIN629726

Der Kaninchen Polyklonal anti-BSDC1 Antikörper wird verwendet zum Nachweis von BSDC1 in Proben von Human, Maus, Hund, Ratte und Zebrafisch (Danio rerio). Er wurde validiert für WB und IHC.

Kurzübersicht für BSDC1 Antikörper (N-Term) (ABIN629726)

Target: BSDC1 (BSD Domain Containing 1 (BSDC1))

Reaktivität: Human, Maus, Hund, Ratte, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BSDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-BSDC1 Antikörper

Bindungsspezifität: N-Term

Spezifität: BSDC1 antibody was raised against the N terminal of BSDC1

Aufreinigung: Purified

Immunogen: BSDC1 antibody was raised using the N terminal of BSDC1 corresponding to a region with amino acids VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BSDC1 Blocking Peptide, (ABIN5612370), is also available for use as a blocking control in assays to test for specificity of this BSDC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BSDC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BSDC1

Target: BSDC1 (BSD Domain Containing 1 (BSDC1))

Andere Bezeichnung: BSDC1

Hintergrund: BSDC1 may be involved in protein binding.

Molekulargewicht: 17 kDa (MW of target protein)