RGS13 Antikörper (Middle Region)

Produktnummer ABIN629717

Der Kaninchen-Polyklonal Anti-RGS13-Antikörper wurde für WB und IHC validiert. Er ist geeignet zum Nachweis von RGS13 in Proben aus Human und Hund. }

Kurzübersicht für RGS13 Antikörper (Middle Region) (ABIN629717)

Target: RGS13 (Regulator of G-Protein Signaling 13 (RGS13))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RGS13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RGS13 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RGS13 antibody was raised against the middle region of RGS13

Aufreinigung: Purified

Immunogen: RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RGS13 Blocking Peptide, (ABIN935968), is also available for use as a blocking control in assays to test for specificity of this RGS13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RGS13

Target: RGS13 (Regulator of G-Protein Signaling 13 (RGS13))

Andere Bezeichnung: RGS13

Hintergrund: RGS13 encodes a protein which is a member of the regulator of G protein signaling (RGS) family. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation.

Molekulargewicht: 19 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling