RSU1 Antikörper (C-Term)

Produktnummer ABIN629715

Dieses Anti-RSU1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RSU1 in WB und IHC. Geeignet für Human, Maus und Ratte.

Kurzübersicht für RSU1 Antikörper (C-Term) (ABIN629715)

Target: RSU1 (Ras Suppressor Protein 1 (RSU1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RSU1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RSU1 Antikörper

Bindungsspezifität: C-Term

Spezifität: RSU1 antibody was raised against the C terminal of RSU1

Aufreinigung: Purified

Immunogen: RSU1 antibody was raised using the C terminal of RSU1 corresponding to a region with amino acids PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RSU1 Blocking Peptide, (ABIN5615969), is also available for use as a blocking control in assays to test for specificity of this RSU1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSU1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RSU1

Target: RSU1 (Ras Suppressor Protein 1 (RSU1))

Andere Bezeichnung: RSU1

Hintergrund: RSU1 is a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the protein was initially isolated based on its ability to inhibit v-Ras transformation.

Molekulargewicht: 31 kDa (MW of target protein)