FTCD Antikörper (N-Term)

Produktnummer ABIN629713

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FTCD in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für FTCD Antikörper (N-Term) (ABIN629713)

Target: FTCD (Formiminotransferase Cyclodeaminase (FTCD))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FTCD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-FTCD Antikörper

Bindungsspezifität: N-Term

Spezifität: FTCD antibody was raised against the N terminal of FTCD

Aufreinigung: Purified

Immunogen: FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FTCD Blocking Peptide, (ABIN938441), is also available for use as a blocking control in assays to test for specificity of this FTCD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTCD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FTCD

Target: FTCD (Formiminotransferase Cyclodeaminase (FTCD))

Andere Bezeichnung: FTCD

Hintergrund: FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.

Molekulargewicht: 60 kDa (MW of target protein)